Applique murale

Rutoma Wall Light – marble

£121.00

Ou 4x £30.25 avec PayPal et Klarna

New customer offer: −10%−10% on your first order, .
Take advantage
  • Rythme un long couloir ou un salon moderne
  • Marbre véritable — un veinage unique à chaque pièce
  • 30 jours pour l'essayer chez vous, retour gratuit

Simple / Marbre

Secure payment · Tracked shipping · 30-day returns

american_expressapple_paycartes_bancairesklarnamasterpaypalvisa
Not sure this is the right model?3 questions and we’ll tell you which one to choose
Daniel
Need advice? Daniel is here to help you. Send us a photo of your room: we will help you choose the right size, the right material and the right lighting mood.
Rutoma Wall Light – marble★★★★★ 4.7/5£121.00

Features & details

Rutoma Wall Light - Glass beads on a genuine Italian Marble tray
Dimensions & Configurations
+
1-Head Model (Single)
W 12 cm x H 35 cm
2-Head Model (Double)
W 12 cm x H 44 cm
3-Head Model (Triple)
W 12 cm x H 60 cm
Installation
Wall-mounted (Hardwired)
Specifications & Fine Materials
+
Monolithic Plate
Genuine Italian Marble (unique veining)
Diffuser Globe
Opal Glass (Pearl finish)
Mounting Structure
Marble & Precision Metal
Light Source
High-performance integrated LED
IP Rating
IP 20 (indoor use)
Dimmable Function
Non-dimmable (Standard switch)
Voltage
AC 110-240V
Compliance & Safety
CE & UKCA marked
The Rutoma Experience
+

A Timeless Wall Sculpture Enhance your space with the Rutoma wall light, a sculptural work that goes beyond the simple function of lighting to bring an unrivalled touch of prestige to any wall. Designed for the most demanding interiors, this light combines sophisticated design with exceptional build quality, worthy of the finest contemporary art galleries.

The Italian Design Legacy Inspired by the vibrant, daring Italian design of the mid-twentieth century, this exceptional wall light orchestrates a masterful meeting between the raw strength of a majestic marble plate sourced from Italy and the delicacy of blown-glass globes. Every marble plate reveals absolutely unique natural veining, making each wall light an exclusive piece.

The Precious Pearl Effect Available in 1, 2 or 3-head formats to suit the verticality of your architecture, Rutoma creates a fascinating play of light. The opal glass globes give off a creamy clarity, creating the elegant visual effect of precious pearls set upon a casket of stone. Ideal for a modern living room, a long hallway or framing a piece of furniture with presence, it instantly becomes the centrepiece of your interior.

Rutoma Wall Light – marble – Lumsky

A light that dresses a room as much as it lights it

Every Lumsky piece is designed as a decorative object: soft light, texture and immediate visual presence.

Lumière murale

Un halo doux le long du mur

Marbre véritable

Une pierre noble aux veines uniques

Détail précieux

Le marbre habille élégamment le mur

Format discret

Une applique compacte et soignée

Veinage naturel

Chaque veine dessine un motif unique

Décor raffiné

Rehausse couloirs et pièces de vie

Considered down to the detail

From fitting to atmosphere, every detail is thought through for your home.

Pose murale

Se fixe simplement au mur

Couloir, chevet

Idéale en couloir ou tête de lit

En paire

Élégante installée de chaque côté

Pierre pérenne

Le marbre traverse le temps

Chambre, entrée

Parfaite pour un éclairage d'appoint

Marbre poli

Une pierre sélectionnée et polie

Rutoma Wall Light – marble – Lumsky
HANDMADE IN OUR WORKSHOPS

Every piece is shaped by hand

Métal · façonné à la main
  • Blown, turned or assembled by hand.
  • Fine materials worked in the workshop.
  • No two pieces are identical.

Why it’s worth a few euros more

Premier prix

  • Lumière blanche et froide
  • Plastique qui jaunit
  • LED non remplaçable
  • Aucun SAV

Lumsky

  • Lumière chaude 2700K
  • Matières nobles qui durent
  • Pensé avec des électriciens, pose simple
  • Marque française & retours 30 j

Your questions, our answers

Is the light warm or cool?
Warm (2700K), for a cosy atmosphere. No bluish neon-style white.
Do you need an electrician to install it?
Our products are designed with electricians for simple installation. Table lamps and rechargeable lamps: plug straight in. 230V wall light or ceiling light: simple wiring, clear instructions supplied.
What are the delivery times?
Preparation of 1 to 2 days then 3 to 5 days in transit, i.e. 4 to 7 business days on average, in France.
What if I don’t like the product?
You have 30 days to send it back and be refunded. Contact: support@lumsky.com.

Your room deserves better than a neon light

Ordered today, shipped within 24–48h. And if you don’t like it, we’ll take it back within 30 days.

Compliance & safety

Lighting that meets European standards

CE CE marking
RoHS RoHS 2011/65 + 2015/863
ErP Ecodesign / ErP
DEEE DEEE / WEEE
IP / NF Certified IP rating