Applique murale

Vucob Wall Light – ceramic

£111.00

Ou 4x £27.75 avec PayPal et Klarna

New customer offer: −10%−10% on your first order, .
Take advantage
  • Abat-jour en céramique premium à motif floral indigo et bras articulé en laiton massif : un esprit rétro-chic peint main.
  • Douille E27 jusqu'à 40W, dimmable, certifiée zones humides : orientable et chaleureuse, jusqu'en salle de bains.
  • 30 jours pour l'essayer chez vous, retour gratuit

Secure payment · Tracked shipping · 30-day returns

american_expressapple_paycartes_bancairesklarnamasterpaypalvisa
Not sure this is the right model?3 questions and we’ll tell you which one to choose
Daniel
Need advice? Daniel is here to help you. Send us a photo of your room: we will help you choose the right size, the right material and the right lighting mood.
Vucob Wall Light – ceramic★★★★★ 4.7/5£111.00

Features & details

Vucob Wall Light - Indigo blue floral ceramic shade and solid brass arm
Dimensions & Configurations
+
Format
Sculptural Retro-Chic Wall Light
Overall Dimensions
W 17 cm x H 13 cm
Installation
Wall or Ceiling (Hardwired)
Specifications & Fine Materials
+
Exclusive Shade
Premium Ceramic (Indigo blue floral pattern on a white ground)
Arm & Joint
Solid Brass (Brass / Gold finish)
Wall Base
Textured Ceramic (Pure White finish)
Lamp Holder
Standard E26 / E27 (1 Lamp Holder)
Recommended Wattage
40W max bulb (incandescent or LED equivalent) - Not included
Dimmable Function
Dimmer compatible (dimmer not included)
Damp Location Certification
Certified (Ideal for Bathrooms & Covered Outdoor Areas)
Compliance & Safety
CE & UKCA marked
The Vucob Experience
+

The Elegance of Painted Ceramic Enhance your space with this masterpiece of lighting. Designed for the most demanding interiors, the Vucob wall light combines sophisticated design with exceptional build quality. It celebrates the timeless, poetic charm of classic porcelain with its superb shade in ceramic adorned with indigo blue floral motifs, delicately set off by an articulated arm in solid brass.

A Cocoon of Serenity Its bold presence and flawless finishes make it an essential decorative element. Its soft, warm light instantly transforms the atmosphere of your room, creating a cocoon of luxury and serenity. The golden glow of the brass pairs with the purity of the textured white ceramic wall base, bringing a sculptural dimension and a captivating brightness to your interior.

The Ultimate Centrepiece Ideal for a modern living room, an elegant dining room or a refined bedroom, it stands out as the centrepiece of your interior. Rigorously certified for damp locations, the Vucob wall light also makes a majestic appearance framing your bathroom mirror or elevating your covered outdoor spaces, making every moment at home a truly exceptional one.

Vucob Wall Light – ceramic – Lumsky

A light that dresses a room as much as it lights it

Every Lumsky piece is designed as a decorative object: soft light, texture and immediate visual presence.

Éclat mural

Un halo décoratif sur le mur.

Présence murale

Habille un mur sans l'encombrer.

Composition libre

Plusieurs formats à composer.

Ambiance feutrée

Lumière douce, jamais agressive.

Finition soignée

Matières et finitions soignées.

Signature déco

Le point focal de la pièce.

Considered down to the detail

From fitting to atmosphere, every detail is thought through for your home.

Pose murale

Fixation murale simple et propre.

Lumière indirecte

Douce en entrée ou couloir.

Gain de place

Éclaire sans encombrer.

Effet relief

Joue les ombres sur le mur.

En duo

Superbe en paire.

Intemporelle

S'intègre dans tout intérieur.

Vucob Wall Light – ceramic – Lumsky
HANDMADE IN OUR WORKSHOPS

Every piece is shaped by hand

Fait main · façonné à la main
  • Blown, turned or assembled by hand.
  • Fine materials worked in the workshop.
  • No two pieces are identical.

Why it’s worth a few euros more

Premier prix

  • Lumière blanche et froide
  • Plastique qui jaunit
  • LED non remplaçable
  • Aucun SAV

Lumsky

  • Lumière chaude 2700K
  • Matières nobles qui durent
  • Pensé avec des électriciens, pose simple
  • Marque française & retours 30 j

Your questions, our answers

Is the light warm or cool?
Warm (2700K), for a cosy atmosphere. No bluish neon-style white.
Do you need an electrician to install it?
Our products are designed with electricians for simple installation. Table lamps and rechargeable lamps: plug straight in. 230V wall light or ceiling light: simple wiring, clear instructions supplied.
What are the delivery times?
Preparation of 1 to 2 days then 3 to 5 days in transit, i.e. 4 to 7 business days on average, in France.
What if I don’t like the product?
You have 30 days to send it back and be refunded. Contact: support@lumsky.com.

Your room deserves better than a neon light

Ordered today, shipped within 24–48h. And if you don’t like it, we’ll take it back within 30 days.

Compliance & safety

Lighting that meets European standards

CE CE marking
RoHS RoHS 2011/65 + 2015/863
ErP Ecodesign / ErP
DEEE DEEE / WEEE
IP / NF Certified IP rating