Lampe de table

Floralis Table Lamp – etched glass and metal, floral motif

£174.00

Ou 4x £43.50 avec PayPal et Klarna

New customer offer: −10%−10% on your first order, .
Take advantage
  • Un motif floral qui habille une entrée
  • Verre gravé et métal — un motif floral travaillé
  • 30 jours pour l'essayer chez vous, retour gratuit

Secure payment · Tracked shipping · 30-day returns

american_expressapple_paycartes_bancairesklarnamasterpaypalvisa
Not sure this is the right model?3 questions and we’ll tell you which one to choose
Daniel
Need advice? Daniel is here to help you. Send us a photo of your room: we will help you choose the right size, the right material and the right lighting mood.
Floralis Table Lamp – etched glass and metal, floral motif★★★★★ 4.7/5£174.00

Features & details

Floralis recalls the stained-glass lamps of another era: worked glass in blue-tinged shades with a floral motif, carried by a metal frame that traces an Art Nouveau silhouette. Lit, it casts a warm, colourful glow.

Features

  • Stained-glass-style glass with a blue-toned floral motif
  • Metal structure with Art Nouveau styling
  • Colourful, decorative light
  • A true mood piece
  • CE & UKCA Compliance

Specifications

  • Material: Worked glass (floral motif) and metal
  • Light source: Standard-fitting bulb (not included)
  • Mounting: Table

French brand · checked piece by piece · 30-day money-back guarantee.

Floralis Table Lamp – etched glass and metal, floral motif – Lumsky

A light that dresses a room as much as it lights it

Every Lumsky piece is designed as a decorative object: soft light, texture and immediate visual presence.

Lumière colorée

Un verre vitrail aux teintes bleutées

Verre travaillé

Un motif floral façon vitrail

Esprit Art nouveau

Une structure métal au dessin d'antan

Pièce d'ambiance

Un véritable objet décoratif

Finition ouvragée

Un verre gravé au motif floral

Salon ou chevet

Belle au salon comme au chevet

Considered down to the detail

From fitting to atmosphere, every detail is thought through for your home.

Ampoule au choix

Culot standard, ampoule non incluse

Sur une console

Ses reflets colorés animent un meuble

En paire

Deux Floralis pour un décor rétro

Structure durable

Un métal ouvragé fait pour durer

Soir d'ambiance

Diffuse une lumière chaude et colorée

Motif vitrail

Un dessin floral inspiré d'autrefois

Floralis Table Lamp – etched glass and metal, floral motif – Lumsky
HANDMADE IN OUR WORKSHOPS

Every piece is shaped by hand

Métal · façonné à la main
  • Blown, turned or assembled by hand.
  • Fine materials worked in the workshop.
  • No two pieces are identical.

Why it’s worth a few euros more

Premier prix

  • Lumière blanche et froide
  • Plastique qui jaunit
  • LED non remplaçable
  • Aucun SAV

Lumsky

  • Lumière chaude 2700K
  • Matières nobles qui durent
  • Pensé avec des électriciens, pose simple
  • Marque française & retours 30 j

Your questions, our answers

Is the light warm or cool?
Warm (2700K), for a cosy atmosphere. No bluish neon-style white.
Do you need an electrician to install it?
Our products are designed with electricians for simple installation. Table lamps and rechargeable lamps: plug straight in. 230V wall light or ceiling light: simple wiring, clear instructions supplied.
What are the delivery times?
Preparation of 1 to 2 days then 3 to 5 days in transit, i.e. 4 to 7 business days on average, in France.
What if I don’t like the product?
You have 30 days to send it back and be refunded. Contact: support@lumsky.com.

Your room deserves better than a neon light

Ordered today, shipped within 24–48h. And if you don’t like it, we’ll take it back within 30 days.

Compliance & safety

Lighting that meets European standards

CE CE marking
RoHS RoHS 2011/65 + 2015/863
ErP Ecodesign / ErP
DEEE DEEE / WEEE
IP / NF Certified IP rating