Suspension

Oviva Pendant Light – natural travertine

£342.00

Ou 4x £85.50 avec PayPal et Klarna

New customer offer: −10%−10% on your first order, .
Take advantage
  • Court au-dessus d'un îlot ou d'une table
  • Barre en travertin et trois têtes en bois
  • 30 jours pour l'essayer chez vous, retour gratuit

Secure payment · Tracked shipping · 30-day returns

american_expressapple_paycartes_bancairesklarnamasterpaypalvisa
Not sure this is the right model?3 questions and we’ll tell you which one to choose
Daniel
Need advice? Daniel is here to help you. Send us a photo of your room: we will help you choose the right size, the right material and the right lighting mood.
Oviva Pendant Light – natural travertine★★★★★ 4.7/5£342.00

Features & details

Oviva Pendant Light - Raw Travertine cylinder inlaid with Walnut Wood shades
Dimensions & Configurations
+
Format
Linear Architectural Pendant (3 Heads)
Beam Dimensions
W 80 cm x H 10 cm
Wiring & Length
150 cm cables, easily adjustable
Installation
Ceiling (Hardwired)
Specifications & Fine Materials
+
Main Body
Authentic Travertine (Textured Beige)
Integrated Shades
Solid Wood (Walnut Finish)
Frame & Cables
Precision Metal (Black Finish)
Lamp Holders
GX53 Standard (3 lampholders)
Recommended Wattage
5W max bulbs per head (Incandescent or LED equivalent) - Not included
Dimmable Function
Dimmer compatible (dimmer not included)
Voltage
AC 110-240V
Compliance & Safety
CE & UKCA marked
The Oviva Experience
+

The Boldness of Contrasting Materials Enhance your space with this masterpiece of lighting. Designed for the most demanding interiors, the Oviva linear pendant combines sophisticated design with exceptional build quality. Its silhouette is a genuine feat: a majestic tubular beam in raw travertine is delicately pierced by three conical shades in walnut wood solid. The fine materials used in its making guarantee not only outstanding durability but also a breathtaking sculptural aesthetic.

A Cocoon of Luxury and Serenity Designed for directional, intimate lighting, its soft, warm light, guided downwards by the wooden domes, instantly transforms the atmosphere of your room. It avoids glare while beautifully bringing out the textures of your furniture, creating a true cocoon of luxury and serenity.

The Centrepiece of Your Entertaining Suspended from elegant black cables that underline its presence, it seems to float in space. Ideal above an island in a modern kitchen, presiding over an elegant dining room or dressing a vast living space, it stands out as the absolute centrepiece of your interior.

Oviva Pendant Light – natural travertine – Lumsky

A light that dresses a room as much as it lights it

Every Lumsky piece is designed as a decorative object: soft light, texture and immediate visual presence.

Lumière minérale

Une lueur douce filtrée par la pierre

Travertin naturel

Une pierre authentique aux nuances chaudes

Élégance brute

La pierre apporte une présence forte

Volume généreux

Une silhouette pleine et rassurante

Surface veinée

Le travertin révèle ses veines naturelles

Déco intemporelle

S'intègre aux intérieurs sobres et chics

Considered down to the detail

From fitting to atmosphere, every detail is thought through for your home.

Pose plafond

Suspension à installer au plafond

Au-dessus table

Sublime au-dessus d'une table à manger

Pièce unique

Chaque pierre présente un motif propre

Pierre durable

Le travertin défie le temps

Espaces à vivre

Idéale dans les grands salons

Matière naturelle

Une pierre extraite et façonnée à la main

Oviva Pendant Light – natural travertine – Lumsky
HANDMADE IN OUR WORKSHOPS

Every piece is shaped by hand

Métal · façonné à la main
  • Blown, turned or assembled by hand.
  • Fine materials worked in the workshop.
  • No two pieces are identical.

Why it’s worth a few euros more

Premier prix

  • Lumière blanche et froide
  • Plastique qui jaunit
  • LED non remplaçable
  • Aucun SAV

Lumsky

  • Lumière chaude 2700K
  • Matières nobles qui durent
  • Pensé avec des électriciens, pose simple
  • Marque française & retours 30 j

Your questions, our answers

Is the light warm or cool?
Warm (2700K), for a cosy atmosphere. No bluish neon-style white.
Do you need an electrician to install it?
Our products are designed with electricians for simple installation. Table lamps and rechargeable lamps: plug straight in. 230V wall light or ceiling light: simple wiring, clear instructions supplied.
What are the delivery times?
Preparation of 1 to 2 days then 3 to 5 days in transit, i.e. 4 to 7 business days on average, in France.
What if I don’t like the product?
You have 30 days to send it back and be refunded. Contact: support@lumsky.com.

Your room deserves better than a neon light

Ordered today, shipped within 24–48h. And if you don’t like it, we’ll take it back within 30 days.

Compliance & safety

Lighting that meets European standards

CE CE marking
RoHS RoHS 2011/65 + 2015/863
ErP Ecodesign / ErP
DEEE DEEE / WEEE
IP / NF Certified IP rating