Applique murale

Tipin Wall Light – natural travertine

€125,99

Ou 4x €31,49 avec PayPal et Klarna

New customer offer: −10%−10% on your first order, .
Take advantage
  • Sublime un salon ou une salle de bains
  • Travertin naturel — chaque pièce a son veinage unique
  • 30 jours pour l'essayer chez vous, retour gratuit

Secure payment · Tracked shipping · 30-day returns

american_expressapple_paycartes_bancairesklarnamasterpaypalvisa
Not sure this is the right model?3 questions and we’ll tell you which one to choose
Daniel
Need advice? Daniel is here to help you. Send us a photo of your room: we will help you choose the right size, the right material and the right lighting mood.
Tipin Wall Light – natural travertine★★★★★ 4,7/5€125,99

Features & details

Tipin Wall Light - Asymmetric raw Travertine block and opal Glass globe
Dimensions & Configurations
+
Format
Sculptural Wall Light (Wabi-Sabi)
Overall Dimensions
W 12 cm x H 22 cm
Installation
Wall or Ceiling (Hardwired)
Specifications & Fine Materials
+
Architectural Body
Raw Authentic Travertine (Textured porous beige)
Diffuser Globe
Premium Opal Glass (Pure White)
Lamp Holder
Standard G9 (1 Lamp Holder)
Recommended Wattage
10W max bulb (incandescent or LED equivalent) - Not included
Dimmable Function
Dimmer compatible (dimmer not included)
Damp Location Certification
Certified (Ideal for Bathrooms & Covered Outdoor Areas)
Compliance & Safety
CE & UKCA marked
The Tipin Experience
+

Perfect Mineral Balance The perfect union of art and function. This jewel of illumination was conceived by our finest designers to deliver a truly singular visual experience. The Tipin wall light stands apart with an organic silhouette of absolute poetry: a majestic asymmetric block carved from Genuine travertine holds, in perfect balance on its edge, a pure globe of opal glass.

A Captivating Glow Its bold presence and flawless finishes make it an essential decorative element. Bring a sculptural dimension and a captivating brightness to your interior: the soft, warm light of the glass caresses the porous surface of the stone, creating a fascinating contrast that instantly turns the atmosphere of your room into a true cocoon of luxury and serenity.

The Ultimate Centrepiece Enhance your space with this masterpiece of lighting. Designed for the most demanding interiors, this light combines sophisticated design with exceptional build quality. Ideal for a modern living room, an elegant dining room or a refined bedroom, it stands out as the centrepiece of your interior. Rigorously certified for damp locations, it will also bring its majestic architectural aura to your bathroom.

Tipin Wall Light – natural travertine – Lumsky

A light that dresses a room as much as it lights it

Every Lumsky piece is designed as a decorative object: soft light, texture and immediate visual presence.

Lumière tamisée

La pierre diffuse une lueur douce

Travertin naturel

Une pierre authentique aux tons sable

Présence minérale

Le travertin sublime le mur

Format soigné

Une applique compacte et pleine

Surface veinée

Les nuances de la pierre révélées

Déco épurée

S'intègre aux ambiances minimalistes

Considered down to the detail

From fitting to atmosphere, every detail is thought through for your home.

Pose murale

Se fixe simplement au mur

Couloir, chevet

Idéale en tête de lit ou couloir

En paire

Superbe installée par deux

Pierre pérenne

Le travertin traverse le temps

Chambre, salon

Parfaite en éclairage d'appoint

Pièce unique

Chaque pierre présente un motif propre

Tipin Wall Light – natural travertine – Lumsky
HANDMADE IN OUR WORKSHOPS

Every piece is shaped by hand

Fait main · façonné à la main
  • Blown, turned or assembled by hand.
  • Fine materials worked in the workshop.
  • No two pieces are identical.

Why it’s worth a few euros more

Premier prix

  • Lumière blanche et froide
  • Plastique qui jaunit
  • LED non remplaçable
  • Aucun SAV

Lumsky

  • Lumière chaude 2700K
  • Matières nobles qui durent
  • Pensé avec des électriciens, pose simple
  • Marque française & retours 30 j

Your questions, our answers

Is the light warm or cool?
Warm (2700K), for a cosy atmosphere. No bluish neon-style white.
Do you need an electrician to install it?
Our products are designed with electricians for simple installation. Table lamps and rechargeable lamps: plug straight in. 230V wall light or ceiling light: simple wiring, clear instructions supplied.
What are the delivery times?
Preparation of 1 to 2 days then 3 to 5 days in transit, i.e. 4 to 7 business days on average, in France.
What if I don’t like the product?
You have 30 days to send it back and be refunded. Contact: support@lumsky.com.

Your room deserves better than a neon light

Ordered today, shipped within 24–48h. And if you don’t like it, we’ll take it back within 30 days.

Compliance & safety

Lighting that meets European standards

CE CE marking
RoHS RoHS 2011/65 + 2015/863
ErP Ecodesign / ErP
DEEE DEEE / WEEE
IP / NF Certified IP rating