Plafonnier

Kugoc Ceiling Light – marble

€115,99

Ou 4x €28,99 avec PayPal et Klarna

New customer offer: −10%−10% on your first order, .
Take advantage
  • Rythme un couloir, un hall ou un dressing
  • Marbre Bulgari poli à la main, veinage unique
  • 30 jours pour l'essayer chez vous, retour gratuit

Secure payment · Tracked shipping · 30-day returns

american_expressapple_paycartes_bancairesklarnamasterpaypalvisa
Not sure this is the right model?3 questions and we’ll tell you which one to choose
Daniel
Need advice? Daniel is here to help you. Send us a photo of your room: we will help you choose the right size, the right material and the right lighting mood.
Kugoc Ceiling Light – marble★★★★★ 4,7/5€115,99

Features & details

Kugoc Ceiling Light - Bulgari Marble cylinder and Pearl Black Metal
Dimensions & Configurations
+
Format
Compact Architectural Ceiling Light
Overall Dimensions
Ø 12 cm x H 13 cm
Volume Detail
Metal Base: H 3 cm | Marble Cylinder: H 10 cm
Installation
Ceiling (fixed electrical wiring)
Specifications & Fine Materials
+
Sculptural shade
Genuine Bulgari Marble (Unique natural veining)
Base & Mounting
Precision Metal (Pearl Black finish)
Lamp Holder
Standard E26 / E27
Light Source
LED bulb recommended (Not included)
Lighting Zone
Best suited to 5-10 m²
IP Rating
IP20 (indoor use)
Voltage
110V-240V Universal
Compliance & Safety
CE & UKCA marked
The Kugoc Experience
+

The Excellence of Bulgari Marble Enhance your space with the Kugoc ceiling light. This compact architectural masterpiece puts centre stage the prestigious Bulgari Marble, an exceptional natural stone prized worldwide for its rich, dramatic and unpredictable veining. The result of remarkable craftsmanship, each cylinder is meticulously hand-polished, revealing absolutely unique textures and patterns that make your light an exclusive piece.

A Magnetic Contrast Topped with an elegant canopy in pearl black finished metal, this creation sets up a striking visual contrast between the raw, ancient strength of the rock and the finesse of contemporary metalwork. When lit, the stone comes alive: light filters subtly through the marble, creating a warm, hushed and deeply soothing atmosphere.

The Timeless Luxury Accent Designed for the most demanding interiors, this 13 cm high ceiling light is elegance distilled. It is the ideal piece to bring rhythm to the ceiling of a long hallway, light an entrance hall with presence, or add the final touch of sophistication to a high-end dressing room. The Kugoc ceiling light is the essential finishing touch for a distinguished, confident interior.

Kugoc Ceiling Light – marble – Lumsky

A light that dresses a room as much as it lights it

Every Lumsky piece is designed as a decorative object: soft light, texture and immediate visual presence.

Lumière feutrée

Une clarté douce et enveloppante

Marbre véritable

Une pierre noble aux veines uniques

Luxe discret

Le marbre signe une élégance immédiate

Ligne compacte

Un profil épuré près du plafond

Veinage naturel

Chaque veine dessine un motif unique

Intérieurs chics

Rehausse les décors raffinés

Considered down to the detail

From fitting to atmosphere, every detail is thought through for your home.

Montage plafond

Fixation au ras du plafond

Entrée, couloir

Parfait dans les espaces de passage

Pièce unique

Aucun marbre n'est identique

Pierre pérenne

Le marbre traverse les décennies

Chambre, salon

S'adapte aux pièces intimes ou communes

Marbre poli

Une pierre sélectionnée et polie avec soin

Kugoc Ceiling Light – marble – Lumsky
HANDMADE IN OUR WORKSHOPS

Every piece is shaped by hand

Métal · façonné à la main
  • Blown, turned or assembled by hand.
  • Fine materials worked in the workshop.
  • No two pieces are identical.

Why it’s worth a few euros more

Premier prix

  • Lumière blanche et froide
  • Plastique qui jaunit
  • LED non remplaçable
  • Aucun SAV

Lumsky

  • Lumière chaude 2700K
  • Matières nobles qui durent
  • Pensé avec des électriciens, pose simple
  • Marque française & retours 30 j

Your questions, our answers

Is the light warm or cool?
Warm (2700K), for a cosy atmosphere. No bluish neon-style white.
Do you need an electrician to install it?
Our products are designed with electricians for simple installation. Table lamps and rechargeable lamps: plug straight in. 230V wall light or ceiling light: simple wiring, clear instructions supplied.
What are the delivery times?
Preparation of 1 to 2 days then 3 to 5 days in transit, i.e. 4 to 7 business days on average, in France.
What if I don’t like the product?
You have 30 days to send it back and be refunded. Contact: support@lumsky.com.

Your room deserves better than a neon light

Ordered today, shipped within 24–48h. And if you don’t like it, we’ll take it back within 30 days.

Compliance & safety

Lighting that meets European standards

CE CE marking
RoHS RoHS 2011/65 + 2015/863
ErP Ecodesign / ErP
DEEE DEEE / WEEE
IP / NF Certified IP rating