Suspension

Ecim Pendant Light – natural travertine

€115,99

Ou 4x €28,99 avec PayPal et Klarna

New customer offer: −10%−10% on your first order, .
Take advantage
  • Éclaire une table à manger ou un séjour
  • Travertin et bois de noyer — chaleur minérale
  • 30 jours pour l'essayer chez vous, retour gratuit

Simple / Travertin

Secure payment · Tracked shipping · 30-day returns

american_expressapple_paycartes_bancairesklarnamasterpaypalvisa
Not sure this is the right model?3 questions and we’ll tell you which one to choose
Daniel
Need advice? Daniel is here to help you. Send us a photo of your room: we will help you choose the right size, the right material and the right lighting mood.
Ecim Pendant Light – natural travertine★★★★★ 4,7/5€115,99

Features & details

A. Pendant Light | Ecim sculptural design in Travertine and Solid Walnut
Dimensions & Format
+
Single Shade (1 Head)
Size
Ø 12cm x H 15cm
Double Shade (2 Heads, Linear)
Size
W 60cm x H 150cm
Triple Shade (3 Heads, Circular)
Size
Ø 30cm x H 150cm
Triple Shade (3 Heads, Linear)
Size
W 60cm x H 150cm
Cable
150cm (adjustable)
Installation
Hardwired (integrated wall/ceiling wiring)
Exclusive Details & Materials
+
Main Materials
Genuine Travertine Stone & Solid Walnut
Diffuser
Direct (No visible diffuser)
Lamp Holder Type
G9 Lampholder
Recommended Wattage
40W Max (or LED equivalent)
Voltage
AC 110-240V
Dimmer
Compatible (not included)
Installation
Hardwired (Integrated wall/ceiling wiring), Suitable for sloped ceilings (<30°)
Compliance & Safety
CE & UKCA marked
The Ecim Experience
+

Pure Organic Elegance The Ecim Pendant is the perfect union of art and function, a truly tactile jewel of illumination. Designed for the most demanding interiors, this minimalist light masterfully fuses the raw, porous texture of genuine travertine with the organic warmth of hand-brushed solid walnut. The tactile contrast between elemental stone and rich wood creates a captivating sculptural presence, making every moment spent at home a truly exceptional one.

A Tactile Architectural Masterpiece Conceived by our finest designers, Ecim embodies sophisticated design without compromise. Its cylindrical travertine stone shade casts a captivating glow that underlines the unique mineral veining of each piece. Its bold presence and impeccable finish make it an essential decorative element: a pared-back hardwired piece that brings an architectural dimension to your interior.

Captivating Illumination & Mounting Versatility Turn lighting into a sensory ritual. Fully dimmable, Ecim shapes the mood of your living room, kitchen or dining room. Its modularity (available in single, double or triple-head configurations, in linear or circular formats) and its adjustable 150cm cable give you complete hardwired installation freedom, including on sloped ceilings (<30°). Bring this sculptural presence and captivating glow into your home.

Ecim Pendant Light – natural travertine – Lumsky

A light that dresses a room as much as it lights it

Every Lumsky piece is designed as a decorative object: soft light, texture and immediate visual presence.

Lumière chaude

Une clarté douce et accueillante

Pierre et noyer

Travertin naturel et bois foncé réunis

Contraste élégant

Pierre claire et bois profond dialoguent

Format équilibré

Des proportions justes et soignées

Fini naturel

Matières nobles laissées à leur beauté

Ambiance feutrée

Réchauffe les intérieurs contemporains

Considered down to the detail

From fitting to atmosphere, every detail is thought through for your home.

Pose plafond

Suspension à fixer au plafond

Îlot ou table

Belle au-dessus d'une cuisine ouverte

En duo

Superbe installée par paire

Matières durables

Pierre et bois vieillissent joliment

Salon, cuisine

Parfaite dans les espaces conviviaux

Pièce unique

Le travertin dévoile un motif inédit

Ecim Pendant Light – natural travertine – Lumsky
HANDMADE IN OUR WORKSHOPS

Every piece is shaped by hand

Fait main · façonné à la main
  • Blown, turned or assembled by hand.
  • Fine materials worked in the workshop.
  • No two pieces are identical.

Why it’s worth a few euros more

Premier prix

  • Lumière blanche et froide
  • Plastique qui jaunit
  • LED non remplaçable
  • Aucun SAV

Lumsky

  • Lumière chaude 2700K
  • Matières nobles qui durent
  • Pensé avec des électriciens, pose simple
  • Marque française & retours 30 j

Your questions, our answers

Is the light warm or cool?
Warm (2700K), for a cosy atmosphere. No bluish neon-style white.
Do you need an electrician to install it?
Our products are designed with electricians for simple installation. Table lamps and rechargeable lamps: plug straight in. 230V wall light or ceiling light: simple wiring, clear instructions supplied.
What are the delivery times?
Preparation of 1 to 2 days then 3 to 5 days in transit, i.e. 4 to 7 business days on average, in France.
What if I don’t like the product?
You have 30 days to send it back and be refunded. Contact: support@lumsky.com.

Your room deserves better than a neon light

Ordered today, shipped within 24–48h. And if you don’t like it, we’ll take it back within 30 days.

Compliance & safety

Lighting that meets European standards

CE CE marking
RoHS RoHS 2011/65 + 2015/863
ErP Ecodesign / ErP
DEEE DEEE / WEEE
IP / NF Certified IP rating