Suspension

Edoku Pendant Light – multiple sizes

€189,99

Ou 4x €47,49 avec PayPal et Klarna

New customer offer: −10%−10% on your first order, .
Take advantage
  • S'adapte à une table ou un îlot
  • Travertin et bois — plusieurs tailles au choix
  • 30 jours pour l'essayer chez vous, retour gratuit

Simple 30 cm

Secure payment · Tracked shipping · 30-day returns

american_expressapple_paycartes_bancairesklarnamasterpaypalvisa
Not sure this is the right model?3 questions and we’ll tell you which one to choose
Daniel
Need advice? Daniel is here to help you. Send us a photo of your room: we will help you choose the right size, the right material and the right lighting mood.
Edoku Pendant Light – multiple sizes★★★★★ 4,7/5€189,99

Features & details

Edoku Pendant Light - Wabi-Sabi design in Travertine with Walnut Wood Sphere
Dimensions & Configurations
+
Format
Wabi-Sabi Pendant (Single or Linear Cluster)
Single 30 cm
Ø 30 cm x H 9.5 cm
Single 40 cm
Ø 40 cm x H 9.5 cm
Double
W 60 cm x H 150 cm
Triple
W 100 cm x H 150 cm
Wiring & Length
Easily adjustable 150 cm cables
Ceiling Compatibility
Suitable for sloped ceilings (< 30°)
Specifications & Fine Materials
+
Main Ring
Authentic Travertine Stone (textured beige)
Central Ornament
Solid Wood Sphere (Walnut Finish)
Frame & Accents
Precision Metal (Black Finish)
Lighting Technology
Integrated Circular LED Strip (Indirect halo)
LED Lifespan
~ 50,000 Hours (Non-replaceable)
Colour Temperature
Warm White 3000K
Voltage
AC 110-240V
Compliance & Safety
CE & UKCA marked
The Edoku Experience
+

Wabi-Sabi Harmony Raised to an Art Enhance your space with this masterpiece of lighting. Designed for the most demanding interiors, the Edoku pendant is an ode to the Wabi-Sabi philosophy. It stages the poetic encounter between the pure geometry of a sphere in walnut wood and the natural imperfection of a floating ring in textured solid travertine. This light combines sophisticated organic design with exceptional build quality.

A Suspended Halo of Light As night falls, the magic happens. The circular LED strip, perfectly integrated and invisible, casts a 3000K Warm White halo that washes across the porous surface of the stone from within. This soft, warm light instantly transforms the mood of your room, creating a cocoon of luxury, intimacy and absolute serenity.

Modular Architectural Elegance Designed to suit your grandest spaces, the Edoku pendant ranges from a delicate single piece to majestic linear compositions of 2 or 3 heads (up to 100 cm across). Ideal above a contemporary kitchen island, over an elegant dining table or in a refined bedroom, it stands as the centrepiece of your decor.

Edoku Pendant Light – multiple sizes – Lumsky

A light that dresses a room as much as it lights it

Every Lumsky piece is designed as a decorative object: soft light, texture and immediate visual presence.

Lumière douce

Une clarté chaleureuse et tamisée

Pierre et bois

Travertin naturel associé au bois chaud

Duo de matières

Le mariage pierre-bois séduit le regard

Plusieurs tailles

Un format à choisir selon l'espace

Finition naturelle

Veines et veinages mis en valeur

Style chaleureux

S'accorde aux intérieurs naturels

Considered down to the detail

From fitting to atmosphere, every detail is thought through for your home.

Pose plafond

Suspension à fixer au plafond

Au-dessus table

Idéale sur une table à manger

En composition

Belle regroupée en plusieurs tailles

Matières durables

Pierre et bois traversent le temps

Salon, cuisine

Parfaite dans les pièces à vivre

Pièce unique

Chaque pierre offre un motif propre

Edoku Pendant Light – multiple sizes – Lumsky
HANDMADE IN OUR WORKSHOPS

Every piece is shaped by hand

Métal · façonné à la main
  • Blown, turned or assembled by hand.
  • Fine materials worked in the workshop.
  • No two pieces are identical.

Why it’s worth a few euros more

Premier prix

  • Lumière blanche et froide
  • Plastique qui jaunit
  • LED non remplaçable
  • Aucun SAV

Lumsky

  • Lumière chaude 2700K
  • Matières nobles qui durent
  • Pensé avec des électriciens, pose simple
  • Marque française & retours 30 j

Your questions, our answers

Is the light warm or cool?
Warm (2700K), for a cosy atmosphere. No bluish neon-style white.
Do you need an electrician to install it?
Our products are designed with electricians for simple installation. Table lamps and rechargeable lamps: plug straight in. 230V wall light or ceiling light: simple wiring, clear instructions supplied.
What are the delivery times?
Preparation of 1 to 2 days then 3 to 5 days in transit, i.e. 4 to 7 business days on average, in France.
What if I don’t like the product?
You have 30 days to send it back and be refunded. Contact: support@lumsky.com.

Your room deserves better than a neon light

Ordered today, shipped within 24–48h. And if you don’t like it, we’ll take it back within 30 days.

Compliance & safety

Lighting that meets European standards

CE CE marking
RoHS RoHS 2011/65 + 2015/863
ErP Ecodesign / ErP
DEEE DEEE / WEEE
IP / NF Certified IP rating